PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10040386
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MYB
Protein Properties Length: 1650aa    MW: 178851 Da    PI: 6.4729
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10040386genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding25.53e-08800840446
                      S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      WT eE ++++d  +  G++ +k+Ia+ +  ++t  +c+++++k
      Lus10040386 800 WTLEERQIFIDKLASCGKD-FKKIASFLE-HKTTADCVEFYYK 840
                      *****************99.*********.***********98 PP

2Myb_DNA-binding29.61.7e-0910071048447
                       S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding    4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47  
                       WT  E   +v+av ++G++ +++I+++++ +R+  qck ++ k 
      Lus10040386 1007 WTDKEKSAFVQAVSLYGKN-FALISHCVQ-TRSQDQCKVFFSKT 1048
                       *****************99.*********.********988775 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.2E-12783845IPR009057Homeodomain-like
PROSITE profilePS5129314.829795846IPR017884SANT domain
SMARTSM007174.5E-8796844IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.6E-4799840IPR009057Homeodomain-like
PfamPF002499.3E-6800840IPR001005SANT/Myb domain
CDDcd001679.22E-7800841No hitNo description
PROSITE profilePS5129312.24610021053IPR017884SANT domain
SMARTSM007174.7E-810031051IPR001005SANT/Myb domain
SuperFamilySSF466897.33E-1010051052IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.6E-510061048IPR009057Homeodomain-like
CDDcd001675.07E-610071045No hitNo description
PfamPF002491.7E-710071046IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1650 aa     Download sequence    Send to blast
MPAEPFSLDR KKHERSESSS SSFGSAPRWR EWSSGHYGSY RELGPRWAGG SGELRRPSGH  60
GKQGWHLSPE QSGYGYTRSR SSDRMQEDEN GRLPFSRVNG KYGRTGRDNR GLSGLRDWKN  120
HSWEMNDGSP FGPGRSHDVS NDQRSVDDML THPPSHPPNS DFVNTWNQLQ LKEHQDHNNE  180
EGTNVLTSGQ RGEKASSLDW KPLKWARGGN LSSRGSGFRY SSSSKSIGAV DSNGGKNEVL  240
PLDNVTSIQS PSKDAAATDG NSAAPSDEIT SRKKPRLTWG QGLAKFEKKR GEGPEISGTR  300
DDRPLFAMNA DPVHSQSSSL VDRSPRLMGF PDSPATPSSV ACSSSPGTEE KFSVKALGID  360
NDASNLYGSP YANSQSHLEE LSLDIEKLDS SLITSLGSSL TEMIQSDNLC SADSSSVKLA  420
GMSKLLVWKG DVLKALETAE SEIDMLENEL KLLKSDSKSK LSCPSPSSSL LNRGSIVCNE  480
LKNVSGNALC RPSTLKVVSS RDEIHNSDDA FDGDGGAKDD ANSPGTATTK FVELVSSTRI  540
SSEMLICDEQ SGLGPAKHPN LDLKVAVPVV QEKDFAVSAS EGDFLVHCNT SKPVYASRSS  600
VANGEDYLCT AILSSNKVSA SAAAEEFNRL LSSDPCSVDC SRVANILSLQ SDALIKQNFL  660
MRKRPVKFKE KMVALKFKAF QHLWREDKRS LSVKKSKSKF QKKLESSSRP ISNMDKKHRS  720
SSRLRVCLSG SLGLVPTPDV LKFTRKLLAD CNAKVYRDKL KMPAQILDEK EKVASRFISR  780
NGLVEDPCAV ERERAMINLW TLEERQIFID KLASCGKDFK KIASFLEHKT TADCVEFYYK  840
NHKSESFGKM KKNKQSKSSA NYLMSSNKKW NREMNAAPLE ILSAGSVLAA DSGRSMGSRK  900
MQTGRILIRG PGNCTIMEDG DCNSDRSNNY DMIVSERETA AADVLAGISG SVSSCITTAD  960
RGEGFHEFKS QKRATVDRCL SLSDATQSVD EETCSDNSCG EMDPADWTDK EKSAFVQAVS  1020
LYGKNFALIS HCVQTRSQDQ CKVFFSKTRK CLALDQIRSC EDAVGPSVIE DANGGGSDME  1080
QGNVMDKGLN KLSSEVDCDL PYSDMFTAGV SNLESNLHIS EDKDVAGSIE GAGLLNANAL  1140
VSDCPKEHLL QSSPLADGEV INGSESSIKG QKVQIEPGVI ASEKDGGASD GFANSGIAED  1200
VVDSAPSNLV SSFEDEARKE VHASLGNQEN SFPHPKASSQ SCLIQDLNTT KEVPHPPWDM  1260
GSSNDSHGVE NINQRQVEVN SVETSVAMSL PMESNMASSD SVIQHSAAVH DSGGISASVD  1320
VHQNGDRDDA KFCENGDVLP LLSVGESSQI ITKQFVAEGP HLQKPSNSEG QCSATELSLL  1380
SQHSEQANRQ SHSFSDMEKP CRNGDVKLFG KILSNTASSS HKPNTEYGKD GKSSHPVKTG  1440
SPATLNFTGH PSADGNATLL SFDPNSCLGS ENLLPQRSYG FWDGRRIRMG VSSLPDSAIL  1500
LAKYPDAFSN YQGHPPKILT NSERSINGLP KFPSRDASSS STALLDLQRY ITQDANKFEP  1560
FALERQEVLD LQARKGFDSI PSLQQQGRAM GMSIAGRGGV LIGGPCQAIS DPVAAIKMHF  1620
AKTDRVGVQS GTVNPRQDEP WRGQGDARR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4a69_C1e-14762847993NUCLEAR RECEPTOR COREPRESSOR 2
4a69_D1e-14762847993NUCLEAR RECEPTOR COREPRESSOR 2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012086506.10.0PREDICTED: uncharacterized protein LOC105645502
TrEMBLA0A067K1T60.0A0A067K1T6_JATCU; Uncharacterized protein
STRINGPOPTR_0010s22670.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF49863352
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G52250.11e-111MYB family protein